PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00028581-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 790aa    MW: 87858 Da    PI: 6.4423
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00028581-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS399.53.4e-1224127812373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.fsevsPilkf 93 
                       ++lL+ecA+a+s+g+  +a +++ +l  l s +gdpmqRl+ay++e+L arl  s ++ly++l+ +et+   +++  +a++l +++v+P+++f
  PSME_00028581-RA 412 RKLLVECATAISEGESDNALTIIMKLMPLISVYGDPMQRLTAYMVEGLVARLGPSAQSLYDTLKWKETP---TKDISSATRLqLYKVCPYIEF 501
                       689*****************************************************************9...67777777778********** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       ++++a ++Ilea+++ee+vHiiDf+i++   +++L+++L+++ +gpp+lRiT+v++p+s       l+ ++e+L++fA++lgv++ef++ + +
  PSME_00028581-RA 502 GYMAAISTILEALKEEEKVHIIDFEIGEANLYANLIRKLSAKVGGPPKLRITAVDDPDSIsrCVGDLHMVQEQLKNFATRLGVHLEFQI-IPQ 593
                       *********************************************************99988999***********************9.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       + ed+++ +L+++p+EalaVn+++qlh+++desvs++++rd++L++vk+lsPkvv+vve+e+++n+++Fl rf+eal+yysa+f+sl+  l r
  PSME_00028581-RA 594 KAEDIQPYMLDCRPDEALAVNFAFQLHHMPDESVSTRNPRDQLLRMVKGLSPKVVTVVEKEMNTNTAPFLPRFMEALNYYSAVFESLDIRLKR 686
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       es+er ++E+++l+r+ivn+vacegaer+er e ++kWr+r+++aGF+  p++++++++++ll + ++++ yr++ee+g+l +gW d+ Lv+v
  PSME_00028581-RA 687 ESRERFNIEKQCLARDIVNIVACEGAERIERYEVAGKWRARMTMAGFTMHPINTSVYDSVRLLFESYGNK-YRLKEEKGALHFGWLDKVLVVV 778
                       ********************************************************************66.********************** PP

              GRAS 371 SaW 373
                       SaW
  PSME_00028581-RA 779 SAW 781
                       *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.84385763IPR005202Transcription factor GRAS
PfamPF035141.2E-119412781IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 790 aa     Download sequence    Send to blast
VGDGVVVGGI VEEDLGLCLS ELEPLAECFP GGENKNTKCS QCPPLPLNTL WKLELPSASN  60
AAAAAIYLII VIIIPLGHAC NNGLPCRESC FDPCKSRPLE SSGSSNSEGC LNVGRNNRIG  120
TPPVNPLNVM KLHCRPDLSG MTSNPRAQLG QFTSEIHTQT MELLSKRSLS EMERQVMFRA  180
VRQRNHNAPL LPLSSADSVV LSHSSASPSE SVSSHPYHRH QLNISPCYSP SSICSPASLP  240
TISDFNVEKF LSLPALQSAA ALERPASNQN FAHNHGFILP KLKSPDSHRV AIDNAKTDEY  300
QEGMRHKLQE LERELLSDSD DAFNVSALSP EQSSQLDREW IDTIQNLLSE EAVLHPTISG  360
ESQGYHNSNK ENPTSQASRS QLEDQKHSFS ISSQQQPKTS ATQPRDAASS SRKLLVECAT  420
AISEGESDNA LTIIMKLMPL ISVYGDPMQR LTAYMVEGLV ARLGPSAQSL YDTLKWKETP  480
TKDISSATRL QLYKVCPYIE FGYMAAISTI LEALKEEEKV HIIDFEIGEA NLYANLIRKL  540
SAKVGGPPKL RITAVDDPDS ISRCVGDLHM VQEQLKNFAT RLGVHLEFQI IPQKAEDIQP  600
YMLDCRPDEA LAVNFAFQLH HMPDESVSTR NPRDQLLRMV KGLSPKVVTV VEKEMNTNTA  660
PFLPRFMEAL NYYSAVFESL DIRLKRESRE RFNIEKQCLA RDIVNIVACE GAERIERYEV  720
AGKWRARMTM AGFTMHPINT SVYDSVRLLF ESYGNKYRLK EEKGALHFGW LDKVLVVVSA  780
WHLEPHSKIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4844578237375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1145021e-173BT114502.1 Picea glauca clone GQ03515_N01 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D6R7020.0A0A0D6R702_ARACU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.11e-150SCARECROW-like 1